Page Overview:
Kelly Makepeace is a multifaceted individual with a presence across 14 Facebook profiles, 8 Instagram profiles, 5 Twitter profiles, 4 Quora profiles, 3 Flickr profiles, and 9 MySpace profiles. This summary highlights key aspects of various individuals named Kelly Makepeace.
Public records indicate: Kelly Rose Makepeace, 50, Kelly Evans Makepeace, 41, resides in Washington (WA), Kelsey M Makepeace, 37, Kaitlyn Kelly Makepeace, 29, Kelly Mei-lin Makepeace, Kelly Evans Makepeace, resides in Washington (WA), Kelly R Makepeace, Kelly R Makepeace, resides in Mason, OH, ***** Ashmont Way, Kelly E Makepeace, resides in Washington, NC, ***** Forest Ln, Kelly M Makepeace, resides in Waxhaw, NC, ***** Royal Crescent Ln
Kelly Evans Makepeace, age 41, Washington, NC View Details
Cities: Washington NC, Greenville NC Possible Relatives: Bradley Dana Makepeace, Dana Horton Makepeace, David Evans Shinton
Kelly Rose Makepeace, age 50, Mason, OH View Details
Cities: Mason OH, West Chester OH, Punta Gorda FL Possible Relatives: Abigail R Eaton, Faye C Eaton, James C Eaton
Kelsey M Makepeace, age 37, Spring Park, MN View Details
Cities: Spring Park MN, Appleton MN Possible Relatives: Sherry Lynnlunde Hastings, Alyssa B Heckmann, Beth Anne Heckmann
Kaitlyn Kelly Makepeace, age 29, Wallingford, CT View Details
Cities: Wallingford CT, Durham CT Possible Relatives: Colleen C Makepeace, Conor B Makepeace, Edwin H Makepeace
Kelly Rose Makepeace, age 50, Mason, OH View Details
Locations: Mason OH, West Chester OH, Punta Gorda FL Possible Relatives: Abigail R Eaton, Faye C Eaton
Kelly Evans Makepeace, age 41, Washington, NC View Details
Locations: Washington NC, Greenville NC Possible Relatives: Bradley Dana Makepeace, Dana Horton Makepeace
Kelsey M Makepeace, age 37, Spring Park, MN View Details
Locations: Spring Park MN, Appleton MN Possible Relatives: Sherry Lynnlunde Hastings, Alyssa B Heckmann
Kaitlyn Kelly Makepeace, age 29, Wallingford, CT View Details
Locations: Wallingford CT, Durham CT Possible Relatives: Colleen C Makepeace, Conor B Makepeace
Kelly Mei-lin Makepeace, age 30s, Matthews, NC View Details
Locations: Matthews NC, Winston Salem NC Possible Relatives: Jason D Makepeace, Jeffrey David Makepeace, Karen J Makepeace
Kelly Mei-lin Makepeace, age 30s, Winston Salem, NC View Details
Locations: Winston Salem NC
Kelly Evans Makepeace, age 30s, Washington, NC View Details
Locations: Washington NC, Greenville NC, Newark DE Possible Relatives: Bradley Dana Makepeace, Dana Horton Makepeace, Kimberly Nicole Makepeace
Kelly R Makepeace, age 40s, Mason, OH View Details
Locations: Mason OH, West Chester OH Possible Relatives: Faye C Eaton, James E Eaton, James C Eaton
Kelli E Heneptebeck, age 50s, Saint Petersburg, FL View Details
Locations: Saint Petersburg FL, Largo FL, Savannah GA Possible Relatives: David Lee Casebier, Casey J Hengstebeck, Donna K Hengstebeck
Kelly R Makepeace View Details
Address:***** Ashmont Way, Mason, OH. Phone Number: (513) 325-****
Kelly E Makepeace View Details
Address:***** Forest Ln, Washington, NC. Phone Number: (252) 355-****
Kelly M Makepeace View Details
Address:***** Royal Crescent Ln, Waxhaw, NC. Phone Number: (704) 846-****
Search locality history, phone, age and more.
Kelly Grace (Makepeace) • kelly.grace.545402
Nancy Makepeace (Nancy Kelly) • nancy.makepeace.7
Kelly Maria Fernanda Galicia Makepeace • kellymariafernanda.galiciamakepeace
Kelly Eaton (Kelly Makepeace) • runnermomof2
Kelly Worley Was Makepeace • kelly.worleywasmakepeace
Kelly Makepeace • kelly.makepeace.18
Kelly Makepeace • kelly.makepeace.58
Kelly Makepeace • kelly.makepeace.58
Kelly Makepeace • kelly.makepeace.102
Kelly Makepeace • kelly.makepeace.37
Kelly Makepeace • kelly.makepeace.3
Kelly Makepeace • kelly.makepeace.587
Kelly Makepeace • kelly.makepeace.50
Kelly Makepeace • kelly.makepeace.7
Kelly Makepeace • kelly.makepeace
Kelly Makepeace • kelly_makepeace
Kelly Makepeace • kellymakepeace
Kelly Makepeace • kelmakers
Kelly Makepeace • xxkellyx1987
Kelly Galicia Makepeace • kelly_gali
Kelly • makepeace8
Kelly Makepeace Photography • kellymakepeacephoto
Kelly Makepeace • graytiertza
Kelly Makepeace • kelly_makepeace
Kelly Makepeace • kellymakepeace
Kelly Makepeace • kmakepeace8
KELLY BROWN • SMILE2MAKEPEACE
Kelly Makepeace • kellymakepeace
Kelly Makepeace • kmakepea
Kellymakepeace • kellymakepeace5372
Kelly Makepeace • kelly-makepeace
Kelly Makepeace • kelly-makepeace-1
Kelly Makepeace • kelly-makepeace-2
Kelli Hengstebeck Makepeace • kelli-hengstebeck-makepeace
Kelly Makepeace • moviebuff5
Kelly Makepeace • makey72
Kelly Makepeace • kellymakepeacephoto
Kelly Makepeace • kmakepeace8
Kelly Makepeace • moviebuff5
Emily Makepeace • eminessence
Jenny Makepeace • jmakepeace22
Kersey Makepeace • kerseymakepeace
Hayley Makepeace • hc150922
Jeff Makepeace • jmbuildingllc
Nancy Makepeace • nancy_makepeace
Ann Makepeace • annmakepeace
Denise Makepeace • makepeace
Nikki Makepeace • nikki_makepeace
Nina Makepeace • nmakepea
Sarah Makepeace • sarah_makepeace
Cathryn Makepeace • cathrynmakepeac
Amanda Makepeace • makepeaceart
Mystic Makepeace • mjmakepeace
Sirina Makepeace • sirinamakepeace
Rachael Makepeace • makepeacer
Caroline Makepeace • timocar
Savannah Makepeace • savannahmake612
Kelly Makepeace • kellymakepeace592
4 subscribers
Kelly Makepeace • 156545062
Kelly Makepeace • 234346238
Kelly Makepeace • 236531185
Kelly Makepeace • 387839559
Kelly Makepeace • kayemm15
Kelly Makepeace • movie_buff5
Kelly N Kat Makepeace • 395481415
Kelly Hamilton • makepeace_notwar
Alicia Kelly • makepeace_nowar
P. S. Jones Middle School - Facebook
www.facebook.com › photo.php
Our new PRINCIPAL Kelly Makepeace is coming back to P.S. Jones after serving 4 years as Principal at John Small Elementary School.
Kelly Makepeace - Principal - Beaufort County Schools
www.beaufort.k12.nc.us › domain › 249
I taught 2nd, 3rd and 4th grade and have served as an administrator at John Small School and P.S. Jones Middle School in Washington, NC. I am a two-time ECU ...
Kelly Makepeace - Bob Gold & Associates
bobgoldpr.com › team › kelly-makepeace
Kelly Makepeace is a versatile communications professional with over a decade of experience in media, telecommunications, entertainment and technology.
7 "Kelly Makepeace" profiles - LinkedIn
www.linkedin.com › pub › dir › Kelly › Makepeace
View the profiles of professionals named "Kelly Makepeace" on LinkedIn. There are 7 professionals named "Kelly Makepeace", who use LinkedIn to exchange ...
Kelly Makepeace (@kmakepeace8) / X
www.google.com › search
Mother. Wife. Educator, ECU Pirate Swimmer 02-06, ECU Ed.D candidate, Principal Chocowinity Middle School, Beaufort County Schools NC
Chocowinity Middle School - Staff Directory
www.beaufort.k12.nc.us › domain › 468
6th Science. Email Lisa Lee. Kelly Makepeace; Principal. Email Kelly Makepeace; View Website · 252-946-6191. Chrissy Mauser; Band & General Music. Email Chrissy ...
Kelly-Makepeace Profiles - Facebook
m.facebook.com › public › Kelly-Makepeace
View the profiles of people named Kelly Makepeace. Join Facebook to connect with Kelly Makepeace and others you may know. Facebook gives people the power...
Kelly Makepeace - Associate Account Executive - Bob Gold & Associates
www.linkedin.com › in › kellymakepeace
I am a photographer, artist and media production professional with over a decade of experience in photojournalism, film and television, production management ...
www.imdb.com › name › nm7227636
Kelly Makepeace. Second Unit or Assistant Director: Evelyn. Kelly Makepeace is known for Evelyn (2015).
What's Kelly Makepeace's address?
Kelly Makepeace's address is ***** Ashmont Way, Mason, OH.
What's Kelly Makepeace's phone number?
Kelly Makepeace's phone number is (513) 325-****.
What's Kelly Makepeace's Instagram?
We've discovered several social media accounts associated with Kelly Makepeace, including @kelly.makepeace, @kellymakepeace, @kelmakers, @kelly_gali and others. To explore more of Kelly Makepeace's online presence, click here.
What's Kelly Makepeace's Facebook?
We've discovered several social media accounts associated with Kelly Makepeace, including @kelly.grace.545402, @nancy.makepeace.7, @kellymariafernanda.galiciamakepeace, @runnermomof2 and others. To explore more of Kelly Makepeace's online presence, click here.
Are PeekYou social results accurate?
PeekYou is a free people-focused search engine that uncovers information typically buried by other search engines. Its clean and user-friendly format makes it easy to navigate. The platform offers accurate data and conveniently links to an individual's social media profiles and other public websites with which they are associated.
Search Details
Search Details